Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
$0.00
Men's

Our finest collection of high-end men's cologne oils. Guaranteed to attract compliments wherever you go!

Men's
Creed: Himalaya
Creed: Himalaya
$7.00
Dior: Sauvage
Dior: Sauvage
$7.00
Dior: Sauvage Eau De Parfum
Dior: Sauvage Eau De Parfum
$7.00
50 Cent: Power
50 Cent: Power
$7.00
Burberry: Hero
Burberry: Hero
$7.00
Burberry: Mr. Burberry
Burberry: Mr. Burberry
$7.00
Carolina Herrera: Bad Boy
Carolina Herrera: Bad Boy
$7.00
Chanel: Allure Homme
Chanel: Allure Homme
$7.00
D & G: The One
D & G: The One
$7.00
Dior: Sauvage Very Cool
Dior: Sauvage Very Cool
$7.00
D & G: Light Blue (Men)
D & G: Light Blue (Men)
$7.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i